PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 156aa    MW: 17345.9 Da    PI: 7.3046
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028986genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.3e-41121111100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+r+C+++C++apyf +++pkkfa vhk+FGasnv+k+l+++pee+red+++sl+yeAear+ dPvyG++g i  lq+++ +l+++la ++
  Lus10028986  12 SCAACKFLKRRCTSNCIFAPYFRSDEPKKFAKVHKVFGASNVSKILTEVPEEQREDTVNSLAYEAEARLVDPVYGCIGAIAMLQRKMVELQVDLAIAR 109
                  6*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  ++
  Lus10028986 110 AR 111
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.67111112IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4012109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MKSHHEPRSS SSCAACKFLK RRCTSNCIFA PYFRSDEPKK FAKVHKVFGA SNVSKILTEV  60
PEEQREDTVN SLAYEAEARL VDPVYGCIGA IAMLQRKMVE LQVDLAIARA RLLRCTSAPT  120
GEIGTTFGEF PSMIDGFEQE VPLPISDFSQ FPYIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272821.15e-74PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL88e-61LBD21_ARATH; LOB domain-containing protein 21
TrEMBLD7T4L76e-74D7T4L7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01450.t012e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.15e-62LOB domain-containing protein 21